Inżynieria Rolnicza
Page d’accueil
Lieux de travail
Auteurs
Chercher
Mots-clés indexés dans les articles d’Ingénierie Agricole :
tous | \ | 1 | 2 | A | B | C | D | E | F | G | H | I | J | K | L | M | N | O | P | Q | R | S | Ś | T | U | V | W | X | Y | Z
\
\photointerpretation method
1
1-st generation biofuels
2
2-nd generation biofuels
a
aboratory testsabrasive hullerabrasive wearabrasive wear of steelabsolute humidityabsorbanceabsorbentabsorberabsorptionacademic degree and titleacademic degreesaccess to Internetaccounting for suppliersaccounting softwareaccreditationaccumulationaccuracyaccuracy of positioningacid-proof steel surfacesacoustic emissionacoustic insulating poweracoustic insulation abilityacoustic propertiesacoustic wavesacquiring of informationacquisitionacquisition efficiencyactactivated sludgeactivatet sludgeactivation of learning processactive cultivation machineactive depositactive ventilationactivityactivity registeractual stateactuatoradaptationadaptive controladditional lighting of plantsadequate temperatureadhesion coefficientadhesion forcesadjacent to streambed zoneadjustmentsadjuvantadmissible stressADOADO.NETadsorptionadvanced storageadvancementadvisory serviceaerial photographsaerodynamic streamaerodynamicsafforestationaforestationafter-harvest grain preservationafter-harvest preservation of cerealsafter-shot photographsageage structure of farmersagglomeratingagglomerationaggregateaggregates of vegetable cellsaggregatingagicultural machinesagrarian structureagri-tourismagriculturalagricultural and forestry technologyagricultural landagricultural advisoryagricultural aircraftagricultural and forest technologyagricultural aviationagricultural biogas worksagricultural catchmentagricultural ecosystemAgricultural Engineeringagricultural engineeringagricultural engineering processesagricultural enterpriseagricultural environmentagricultural environmental programsagricultural farmagricultural informationagricultural knowledge representation systemsagricultural landagricultural landscapeagricultural machineagricultural machineryagricultural machinery designagricultural machinery exploitationagricultural machinesagricultural mechanization costagricultural productionagricultural production systemagricultural productive spaceagricultural re-use of sewage sludgesagricultural real estate marketagricultural robotagricultural servicesagricultural soilsagricultural sowersagricultural studiesagricultural techniqueagricultural technologyagricultural technology managementagricultural technosphereagricultural tractoragricultural tractor and machineagricultural tractor engineagricultural tractor marketagricultural tractorsagricultural transportationagricultural useagricultural use of sludgeagricultureagriculture advisingagriculture advisoryagriculture and food industryagriculture mobile robotagriculture tractoragrioultural tractoragritourismagritourist enterprisesagro tourismagro-robotagro-tourismagro-tourist attractivenessagro-tourist infrastructureagro-tourist productagroecosystemagroengineeringagroforestryagroinstalation of the biofuelsagronomical efficiencyagrorobotagrotechnicsagrotourismairair distributionair entrained concreteair exchangeair flowair flow resistanceair flowrateair migrationair motionair movementair pressureair relative humidityair static drop pressureair streamair temperatureairflow resistanceAKP monitoringalginatealgorithmalgorithms of network educationallocationALPRO herd managementalternating pulsationalternative energy sourcesalternative fuelalternative fuelsalternative power engineeringalternative systemsaluminium foilamaranthamaranthusambient temperatureammoniaammonia concentrationammonia emissionamount of labourAMSan optical sensoranalogue–digital cardanalysesanalysisanalysis of costsanalysis of covarianceanalysis of drying processesanalysis of imageanalysis of viewAnalytical Hierarchy Process (AHP)anergyangiospermous barleyangle of internal frictionangle of natural reposeangle of plate positioningangular velocityanimalanimal buildinganimal feed scienceanimal feedinganimal houseanimal modelsanimal productionanimal roomanimal wasteanimal welfareanimalsanionsanniversaryannual use of machinesannual utilization of machineryannual utilization of machinesAnova variance analysisant algorithmant flood safe systemanthocyansantropogenous lansscapeaologyapparent coefficient of the elasticityapparent densityapparent elastic modulusapparent viscosityappleapple cubeapple cubesapple fleshapple orchardapple storage facilitiesapple tree orchardapplesapplicationapplication mapapplicatorappointmentappraisalapproximate setsapproximationArabicaarable areaarable landarable land areaareaarea grouparea of horizontal projectionareas with legal protectionargumentationaromatic compoundarrangement of seedsartificial intelligenceartificial net neuronalartificial neural networkartificial neural networksartificial neuron networksartificial neuronal netasbestosascending springsascorbic acidASP.NETAspergillus nigerassemble milkassemblyassessmentassessment of communesassessment of working standsassignmentsassimilation surfaceassimilation transpirationassistant professorassortment cutting downassumptionassumptionsasymmetry of loadsat-line measurementsattributesaudiometryausterities steelsAustrian pineauthropometryAutoCADautodiagnosisautodiagnosticsAutoLISPautomatic controlautomationautumn plantingavailability of machineryAvena Sativaaverage colour shade
b
backflowbacteriabacteriological propertiesBagley’s methodbailingbake's worthbakerybakery productsbakingbaking ovensbaking valuebalancebalance in farm productionbalance modelbalance of populationbalance roughnessbalance statusbalanced agricultureband drierbar codebarleyBarley dryingbarley dryingbarley grainbarnbarrellingbarriersbarriers for developmentbasic compositionbasinbasket pressbasket willowbatchers of fertilizersBayesian networksBCP1bean podsbean seedbeansbed cultivationbeddingbedding materialbee honey viscositybeech seedsbeefbeef homogenatesbeef taking to piecesbeerbeer bottlingbeer can fillingbeer lossbeet molassesbeet pulpbeet root reactive forcebeetsbehaviourbehaviour of cowsBelorussiabelt separatorbend of beamsbendingberry cropsBeskid Żywieckibest populationsbevametersbig round balesbinding forcebinding substancesbio-refineriesbiodegradable filmbiodegradable materialbiodegradationbiodieselbiodiverisyybioengineeringbiofertilizersbiofuelbiofuelsbiogasbiogenic compoundsbiologicalbiological consolidationbiological pest control agentbiological pesticidesbiological plant pesticidebiological plant protection agentbiological sugar cropbiological sugar yieldbiological value of seedsbiomassbiomass dryingbiomass energybiomass processingbiometric characteristics of a tuberbiometricsBiosensorbiosensorbiostabilizerbiosynthesisbiotechnologybiscuitsbivalent systemblack boxblanchingblast chillingblended learningblowing extrusionboard computerbonesbook of qualitybootstrapboroughBOT systembottlingbottling linesbottom sedimentsBoussinesqu-Fröhlich solutionBoussinesque’s equationBP learningbrake systembreadbread doughbreakdownbreakingbreeding technologybrewer's barleybrewerybrewing effluentbrewing industrybriguetingbriquettesbriquettingBrixbroiler chickensbromocreosol purplebromocreosol purple coefficientbromocresol purple indexbruisebruise energybruise thresholdbruising energyBrussels sproutsbuckwheatbuckwheat flourbuckwheat grainbuckwheat groatsbuckwheat of Emka varietybuckwheat seedbuckwheat seedsbudgetary expendituresbudgetary outlaysbuekwheat seedbuffer zonebuildingbuilding for cattlebuilding for livestockbuilding structuresbuildingsbuilt up areasbulbbulk densityburningburning of fuelsburnishingbusiness intelligencebutterbutter churnbyproducts
c
C:N ratiocabin ventilation systemcableways designCacheCAD systemscalcareous tufascalcium contentcalcium ionscalculation methodscalculation mistakescalculation procedurecalculationscalculative temperaturescalibrating masscalibrationcalibration of seedscaloric valuecalorific effectcalorific valuecanCan busCAN BUS protocolcandidatecanopy section sievecanopy sievecanvassing of the imageCAPcapacitive sensorcapacitycar washercarbon dioxidecarbon monoxidecarbonated structurescargocarotenecarpcarp pondscarriage sprayer with batterycarriers of informationcarrotcarrot classificationcarrot cubecarrot dried materialcarrot pulpcarrot rootcarrot rootscarrot seedscarrot.carrotscascade dryercascade separatorcatch weed seedscatchmentcategorycationscattlecauliflowerCCMcechy jakościowe suszucelerycelery rootcellcell-mattress strengtheningcellscellular materialcementCentral Commissioncentre of mass coordinatescentrifugal distributorcentrifugal fancentrifugal scattering diskcerealcereal combine harvestercereal crop harvestingcereal drillingcereal graincereal grain preparationcereal grainscereal grainy productscereal storagecerealscereals sowingcertificationCFDchaff lengthchain tyreschain webchainsaw cutting systemchamber furnacechampignonschangeschanges in texturechanges in water consumptionchanges of water contentchaoscharacteristiccharacteristicschemicalchemical compositionchemical composition of soilchemical constitutionchemical crop protectionchemical pipingchemical propertieschicken farmchillchilling ratechilling uniformitychimney losseschipschiselschlorophyll fluorescencechoicechoice of machine setschoice of machinerychokeberrychosen units of technical infrastructurechromatic colour coordinateschromingchuteCIEcigaretteCIGRCIOSTACIPCIP systemcitric acidcivilization progressclassical methodclassificationclassification of evaluationsclassification of imagesclean productioncleaner aggregatecleaner of grainscleaningcleaning processcleaning systemcleaning unitcleanlinessclimateclimate parametersclimate physical parametersclimate variablesclod composition of earthcloddinessclosed and open systemsclosed circuitcloud point temperatureCLR - SQL Server 2005clumpclusterclutchCMCCNG delivery to engineCO2 assimilationcoagulantscoagulation testcobscocoa drink powderCode of Good Practicecoefficient of adhesioncoefficient of excess aircoefficient of external frictioncoefficient of frictioncoefficient of restitutioncoefficient of spherical shapecoefficient of the work qualitycoefficient of transverse liquid distribution variabilitycoefficient R2coefficients effectivitycogenerationcohesioncohesion forcecold cured meat productioncold start upcollective machinery usingcollective ripenesscollective use of machinescollector capacitycolloidal suspensionscolorcolor measurementcolor parametersColorado beetleColorado potato beetlecolourcolour measurementcolourscoltercom-bustrion control systemcombi-cookercombination 3 rolls – conecombine adapted to soybean harvestingcombine harvestcombine harvestercombine harvesterscombine harvestingcombine setcombine-harvestercombined sewerage systemcombined systemcombines harvestercombustioncombustion enginecombustion enginescombustion gas analysiscombustion heatcombustion processcomminuted plant materialcomminutioncommitteecommitteesCommon Agricultural Politiccommon osierCommon Railcommunal budgetcommunal marketingcommunecommune managementcommunescommunes spacommunes spascommunications routecommunycompactingcompactioncompactnesscompactness assessmentcomparative analysiscomparative studycomparisoncomparison of regression equationscomposite PDLCcompositioncompostcompost productioncompressioncompression forcecompression testcompression testscompression workcompressive strengthcomputation methodscomputational ambient temperaturescomputer programmecomputer advisory servicescomputer advisory systemscomputer aided decision makingcomputer aided decision making systemcomputer aided evaluationcomputer analysis of picturecomputer analysis of picturecomputer analysis of the imagecomputer analysis of the picturecomputer applicationcomputer application Tracecomputer applicationscomputer applications in agriculturecomputer based knowledge systemscomputer databasescomputer equipmentcomputer image analysescomputer image analysiscomputer image processingcomputer modelcomputer operation standcomputer picture analysiscomputer presentationcomputer programcomputer programmecomputer programs for agriculturecomputer simulationcomputer softwarecomputer supportcomputer systemcomputer systemscomputer technique applicationcomputer technologycomputer testcomputer Trace applicationcomputer visualizationcomputer workplacecomputer–aided advisory systemcomputer’s advisory systemscomputerizationcomputerized image analysiscomputing automationconbustrionconcatenated functionsconcentrationconcentration analysisconceptual graphsconcreteconcrete durabilityconcrete pavementcondensationcondensation planecondition of forestconditionalityconditioningconditioningsconductanceconduction coefficientconductive propertiesconductivityconecone index incrementsconfectioneryconferenceconfidence intervalsconfiguration of milk lineconfusorcongressconiferous tree'consequencesconstant pressure's valveconstructed wetlandconstructed wetlandsconstruction foundationconstruction materialsconstructional and operational parametersconstructional parameterconstructional solutionconstructionsconsumptionconsumption graincontactcontact areacontact strengthcontact surfacecontainercontaminationcontentcontent of starchcontents of dyescontinuous variable transmission (CVT)contrastcontrolcontrol algorithmscontrol chartscontrol of substratecontrol of technological processcontrol-room operatorcontrolled mycorrhizationcontrollingconvectionconvection and vapour furnaceconvection dryingconvection steam ovenconvection-cum-steam furnaceconvection-steam furnaceconvectiveconvective dryingconvector steam ovenconvenience foodconventional tillagecook-chillcoolercooling jacketcooling machinecooling powercooling truck bodycooperationcooperation in agriculturecoordinationcooridnationcoriandercorncorn cob pithcorn graincorn grainscorn hybridscorn pickercorn strawcorrelation and regressive analysiscorrelation coefficientcorrelation coefficientscorrelational and regressive analysiscorrosioncorrosive wearcorrosive-cum-mechanical wearcostcost analysiscost of labourcost of plant protectioncost of productioncostscosts and efficiencies analysiscosts internalizationcosts mechanization of family farmscosts of exploitationcosts of mechanizationcosts of productioncosts of usecosts protectionscosts valuationcoultercountrycountry regionscountry roadcountry roadscountry structurecountryside areascovered crop cultivationcovering extentcovering uniformitycoveringscowcow herd managementcow herd management systemscow milkingcow milking capacitycow shedcow’s teatcowscows’ standscowshedcrack resistancecrackerscreal grain materialcreation of filled productscredit ratingcreep compliancecreep testscreeping with relief testcrisp breadcrispinesscrispnesscristalized honey viscositycriteriacriteria of qualificationcriteria of systematizationcriterioncriterion of function selectioncriterions of ecological agriculturecritical control pointcritical inspection pointscritical knotscritical nodescritical temperaturecritical velocitycropcrop breakdowncrop impuritycrop lossescrop mapcrop of wheatcrop predictioncrop qualitycrop quality evaluationcrop residuecrop residue volumecrop residuescrop structurecrop termcrop yieldcrop-forming means of productioncrop-stand evamationcropland areacroppingcropscrops with limited amount of groundcropstand establishmentcross distributioncross sectioncross-cutting and handlingcross-cutting linescrunchinesscrushingcrushing energycrushing millcrushing processcrushing timecrushing. temperaturecrystalline suspensioncrystallized honeycucumbercucumber seedscucumberscultivarcultivarscultivars of potatoescultivating machinerycultivating unitcultivationcultivation costcultivation systemscultivation technologycultivation treatmentscultivation without ploughingcultivation/growingcultivatorcultivator coultercumulated energycumulated energy consumptioncurd cheesecurrantscurve fittingcustomer’s satisfactioncut frequencycut off datacuttercuttingcutting energycutting forcecutting of soilcutting offcutting resislancecutting resistancecutting resistance unitscutting resistance valuescutting tooth geometrycutting workcycliccyclic loadcylindrical slotted sievecylindrical stack
d
D-GPSdairy cattledairy farmdairy productsdairy wastedamagedamage degreedamage locationdamagesdamages of seedsdamp haydamp proofingdamsdangersdatadata archivingdata basedata basesdata busdata collection sheetsdata conversiondata modelingdata processing and analysisdata sourcesdata transferdata warehousedatabasedatabasesDataMatrixDDEde-crease in consumptiondeciduous treedecision aideddecision support systemsdecision supportDecision Support Systemdecision support systemdecision support systemsdecision takingdecision-making chartdecision-making modeldecomposition of particlesdecontaminationdeep beddingdeep fryingdeep leaveningdeep litterdeep soil cultivationdeep steamingdeep-bed dryingdeflectiondeformabilitydeformationdeformationsdefrostingdefrosting leakdegree of deflectiondegree of expansiondegree of finenessdegree of mixingdehullingdehulling processdehydration by osmosisdehydration/dryingdelayed luminescencedelimitation.delivery tubedelivery van/truckdemanddemand for heatdemand for programsdemand for waterdemand side managementDenavit-Hartenberg notationDenmarkdensitydensity growthdensity of dried fruitsdent corndepressordescending springsdescriptive analysisdesiccationdesigndesign inclination angledesign requirementdesignationdesigningdesigning methoddesorptiondestructiondestruction ofseeddestructive forcedetermined chaos theorydeterministic chaos theorydevelopmentdevelopment of plantsdevelopment of rural areasdevelopment of the rural areasdevelopmental farmsdeviation of normdevice selectiondevicesdew point temperaturęDGPSdiagnosis of agricultural machinesdiagnostic algorithmdiagnostic analysisdiagnostic conclusion algorithmdiagnostic inference algorithmdiagnostic methodsdiagnostic parameterdiagnostic parametersdiagnostic potentialdiagnostic signalsdiagnostic susceptibilitydiagnosticsdiagonal steadiness of sprayingdiagonal tirediameterdiameter increments measurementsdiary productsdichotomic parti-tiondidacticdidactic measurementdidactic serverdidactic testdidacticsdie parametersdielectric methoddielectric propertiesdiesel enginediesel enginesdiesel fuel injection systemdiesel oildiesel oil consumptiondietetic fooddifferential geardifferentiationdigital image analysisdigital measuringdigital photographsdigital techniquedill seedsdilution of mycorrhiza myceliumdimensiondimensioningdimensionsdioxinsdirect costdirect drilldirect drillingdirect expendituredirect incomedirect sheardirect shear testdirect sowingdirect surplusdirections of researchdirtinessdisc cultivatordisc hullerdisciplinesdiscriminalion analysisdiscrimination functionsdiseases resulting from storagedisinfectiondisinfection processdisintegrationdisintegration degreedisintegration of microorganismsdiskdisk harrowdispersed information systemsdispersing platedisplacementdisplacementsdisplay-oriented monitorsdisposaldisseminationdissipationdistancedistance learningdistance teachingdistinguish rocks and potatoesdistortion ratedistributed applicationsdistributed database systemsdistributed systemdistributed systemsdistributiondistribution of componentsdistribution of seed lossesdistributorsdistributors of fielddisturbancedoctordomaindomainsdomestic animal feeddomestic beetdomestic wastedouble row harvesterdouble tyresdowntimedraftdraft resistancedrainagedrainage basindravity seweragedried apple slicesdried carrotdried materialdrift reductiondrilled wellsdrillingdrinking bowlsdrinking water treatmentdrip irrigationdrip lossdrive shaft housingdrive wheeldriverdriver's cabindriving forcedriving torquedrop irrigationdrop measurementdroplet size measuringdroplet tracedropletsdroughtsdroughts appledrum mixerdry curvedry massdry matterdry solidsdry substancedryerdryingdrying agentdrying agent streamdrying configurationdrying facilitiesdrying in a fixed beddrying kineiicsdrying kineticsdrying of fuel chipsdrying of maizedrying processdrying shrinkagedrying shrinkage coefficientdrying temperatureDSSdunghilldunghillsdurabilityduration of milk flow outduration of milkman workduring dryingdust filtersdust filtratedusty fractiondynamic Bayesian Networksdynamic loaddynamic loadsdynamic viscosity diesel enginedynamic-mechanical thermal analysisdynamicsdynamics of changesdynamics of oscillationsdynamie of changesdynamie webpages
e
e-learninge-learning infrastructureearthwormeco-power engineeringecological agricultureecological educationecological efficiencyecological farmecological infrastructureecological land utilizationecological seedsecologyeconomic analysiseconomic coefficientseconomic effectivenesseconomic effectseconomic efficiencyeconomic functioneconomic indicatorseconomic infrastructureeconomic performanceeconomic policyeconomic profitabilityeconomic size of farmseconomical effectivenesseconomical effectiveness indicatoreconomical effectseconomical efficiencyeconomical evaluation and analysiseconomical size of a farmeconomy of resourcesecosystem safertyedible potatoeducationeducation level and typeeducation modeleducational computer systemeducational standardseffect of homogenizationeffective and corrected sliding coefficienteffective heateffective powereffectiveneseffectivenesseffectiveness of didactic processeffectiveness of technical meanseffects of sewage ireatmentefficiencyefficiency and profitability of productionefficiency assessmentefficiency of agricultural aircraftefficiency of processeseffluent treatment plantegzergyEKOLANelastic and viscosity coefficientelasticityelasticity coefficientelasticity moduleelastomer destructionelastomer leak stopperselastoopticselectric current intensityelectric energyelectric energy consumptionelectric energy generationelectric fieldelectric field distributionelectric field stimulationelectric powerelectric power consumptionelectric power distribution systemelectric shock protectionelectrical conductivityelectrical energy consumptionelectrical fieldelectrical systemselectricityelectricity consumptionelectricity productionelectro spark depositionelectro-energetic systemelectro-stimulationelectromagnetic inductionelectromagnetic inductivenesselectromagnetic waveselectromagnetismelectronic learningelectronic potatoelectronical-information systemelementelement of RGBelements of crop production technologyelevatorelimination of emission greenhouse gaseselongationelongation growthemachinery operation in maintenanceembankment angleemergenceemissionemission of dust pollusionemission systemempirical investigationsempirical measurementempirical modelempirical statistical modelempirical verificationemploymentemployment in forestryemulsionenergetic equipmentenergetic and material inputsenergetic chipsenergetic effectivenessenergetic effectsenergetic efficiencyenergetic efficiency indexenergetic needsenergetic parametersenergetic planningenergetic plantsenergetic willowenergeticsenergetistic expendituresenergyenergy and ability to germinationenergy balanceenergy carriersenergy consumptionenergy consumption of chippingenergy consumption of cuttingenergy consumption of the productionenergy consumption per unitenergy consumption structureenergy crisisenergy cropsenergy cuttingenergy effectieness evaluationenergy effectivenessenergy effectiveness indicatorenergy efficiencyenergy expenditureenergy expendituresenergy expensesenergy inputenergy inputsenergy loadsenergy managementenergy marketsenergy measuringenergy planningenergy plantsenergy potentialenergy restitutionenergy steam pressureenergy willowenergy-consumingenergy-efficientenergy-saving screensengineengine characteristicsengine cold startengine constructional modificationsengine flexibilityengine fuelsengine loadengine load cycleengine oilengine run-inengine self-diagnosticsengineeringEngineering Departmentengineering equipmentengineering means of productionenriched cagesensiiing techniqueensilageenthalpyentity relationship diagramentrepreneurshipentropyenvi-ronmcnt managementenvironmentenvironment managementenvironment protectionenvironmentalenvironmental conditionsenvironmental managementenvironmental pollutionenvironmental programmesenvironmental protectionenvironmental protection fundsenvironmental riskenzymatic activityequationsequilibrium moistureequilibrium roughnessequipmentequipment availabilityequipment possession in farmsequipment renovationsequipment-process parametersequivalent thermal networkERDergonomicergonomic analysisergonomic diagnosisergonomic moduleergonomicsergonomie analysisergonomie evaluationergonomyERoEIerror of measurementerror sum of squareserrorserrors absoluteerrors of calculationerrors relativeessential oilsesters of higher fatty acidesters of rapeseed oilestimate valuesestimation methodestimation of distribution parametersestimation of technological processestimation ot distributionESUethyl estersETLEUEU DirectivesEuropean corn saladeuropean fundsEuropean integrationEuropean Size UnitEuropean UnionEuropean Union possibilitieseutroficationevaluationevaluation of washing effectivenessevaporating crystallizerevaporatoreverlasting peaexactitude of short-term prognosesexaminationexchange of heatexcreta containerexhaust gasexhaust gas recirculationexhaust gas toxicityexhaust temperatureexitexpandingexpansionexpenditureexpenditure of labourexpenditure structureexpendituresexpensesexpenses on ITexperimantal testsexperiment-planningexperimental analysisexpert systemexpert systemsexploatationexploitationexploitation costsexponential distributionexpositionexposure timeextensometerexternal characteristicsexternal friction coefficientexternal temperatureexternal wallexternal wall water vapourexternaldamage indexextradite densityextraneus substances transferextrapolation methodextrudateextrudate densityextruderextruder production automationextrusion
f
faba beanfacility for livestockfactor analysisfactor of safetyFaculty of Agriculturai Engiheerlhgfailurefailure frequencyfailure frequency of power networkfalling numberfalling out anglefallowFalse Acaciafamily farmfamily farmsfamily farmsteadfamily incomefamily-operated farmsfamily-owned farmfamily-owned farmsfanfan atomizerfan atomizersfarm tractorsfarmfarm and environmental programfarm animalsfarm buildingfarm companiesfarm enterprisesfarm equipmentfarm facilityfarm householdfarm machinefarm machine advancementfarm machineryfarm machinery marketfarm machinery repairsfarm machinesfarm machines and equipmentfarm machines and toolsfarm machines' componentsfarm managementfarm manurefarm mechanizationfarm production organisation intensityfarm profitabilityfarm spray machinefarm sprayerfarm technical equipmentfarm tractorfarm tractor parametersfarm tractor repairfarm tractorsfarm tractors servicingfarm typefarmerfarmer's agefarmer's educationfarmer’s family incomefarmersfarmers agefarmers incomefarmers' opinionfarmers’ cooperationfarmingfarming engineering costfarming engineering cost factorfarming engineering effectiveness factorfarming landfarming machinefarming technologyfarmsfarms eąuipmentfarmsteadfarmstead outfitfarmsteadsfatfat contentfat content of feedfatiguefattening housefatty acidsFBMfeedfeed distribution technologyfeed fatfeed fiberfeed mixturesfeed pelletsfeed preparation and supplyfeed production plantfeed valuefeedingfeeding compression-ignition enginesfeeding fibrefeedsfeller bunchersfellingFEM (Finite Element Method)fermentationfermentation-ripening chambersfertilisationfertilisers with extended activityfertilityfertilizationfertilization by leavesfertilization of nitrogenfertilization unitfertilizer distributorfertilizer dosesfertilizingFESFFTfiat stream sprayerfield bean seedsfield chaff cutterfield crop productionfield cropsfield experimentationfield experimentsfield extentfield investigationsfield irrigationfield measurementfield operationsfield productionfield researchfield sprayersfield spraying machinefield spraying machinesfield spraying machinęfield testsfiler machinefiliform fungusfiliform fungus Aspergillus nigerfillingfilm investigationfilm monitoringfilm recordingfilm technologyfilm tunnelfilter drainfiltering vegetation stripsfiltrationfinal drivefinal gross productionfinal massfinancial insurancesfinancial sourcesfinancial supply of structural changesfinancingfire protectionfire waterfirm managementfirmnessfirmness of the soilfirst drying periodfishfish bonesfitfive point scaleflakingflaking processflat cultivationflat fan atomizersflat matrixflat plateflat plate solar collectorflat-plate solar collectorflat-stream atomizersflavouring purposesflexibility controlFlexible Bayesia Modelingfloating debrisflood control infrastructureflourflour whitenessflow abilityflow functionflow intensityflow limitflow out intensityflow rateflow rate measurementflow rate of powderflow resistanceflowabilityflowersflowsflows in bio-reactorfluid bedfluid filmfluid mixingfluidizationflywheel chopping unitflywheel cutting unitflywheel shredding unitflywheel unitfnechanization effectivenessfoaming agentsfodderfodder cornfodder feedfodder mixesfodder productionfoil tunnelfood companyfood industryfood marketsfood powderfood powder mixturesfood powdersfood processingfood processing enterprisesfood production machinesfood productsfood quality systemsfood ration energyfood safetyfood safety systemsfood sectorfoodstuffsfor border points of veterinary controlforage harvesterforce sensorforced-in jointforcesforecastforecastingforecastsforecropforesightforestforest accessibilityforest ecosystemforest harvestingforest hydrologyforest organic biomassforest roadforest roadsforest serviceforest stand structureforest standsforest tree seedforestryformform of mechanizationformer farmlandsforming chemical constitutionforms of serviceforwarderforwarding fuelsfotooptic sensorfountain bedfountain bed dehydrationFourier transformFPPframeframe strengthfrater qualityfree and bound waterfree pouringfree softwarefree-position systemfreez dryingfreeze dryingfreeze-dryingfreezingfreezing food productsFrench beanfrequency analysisfrequency of vibrationfresh fish wastesfresh juice fruitfrictionfriction coefficientfriction coefficientsfriction force and momentfriction of grain-structured vegetation materialsfriction weldingfrittingfront loaderfrost resistancefrozen meatfruitfruit discardsfruit dryingfruit fillingsfruit harvestingfruit productionfruit-growing farmfruit-growing productionfruitsfruits’ gelsfryingfuelfuel cellfuel chipsfuel consumptionfuel consumption per hour and per unitfuel injectionfuel injection systemfuel oilfuel supply systemfull grainfumes emissionfumes of enginesfunctional classificationfunctional dependencefunctional diagnosticsfunctional propertiesfunctional shaft outlinefunctioningfunctions of rural areasfungifunnel flow systemfunnel-flow systemfussy controlfussy controllerfussy modelsfuturefuture-oriented trendsfuzzy controlfuzzy logicfuzzy modelsfuzzy relational modelsfuzzy sets
g
Galium aparine L seedsgamma distributiongarbanzogarden framesgarlicgas consumptiongas emissiongas non-membrane air-heatergas proportioning system controllergastronomic machines and devicesgastronomygear boxgelationgellinggelling substancesgelsGembloux methodgeneralized linear modelgenetic algorithmgenetic algorithmsgeocompositesGeographic Information Systemgeographic information systemsGeographical Information Systemgeological structuregeołogical structuregeometric parametersgeometric propertiesgeometrical featuregeometrical featuresgeometrical propertiesgeometrical seed dimensionsgeomorphologygeostatistic functiongeostatistical methodsgeostatisticsgeothermal energyGerman wheat flourgerminationgermination abilitygermination capacitygermination rateGISGIS applicationglassglass transition temperatureglasshouse tomatoesglasshousesglobal productionglucose water solutionsglutengluten contentgluten elasticityglycerine phaseglycerine wasteglyphosateGMOgoat milkingGompertz modelgood agricultural practiceGPSgradinggradual correctiongraduategraduate profilegraduatesgraingrain breaking-up degreegrain combine harvestergrain compositiongrain crushinggrain cutting processgrain damagegrain damagesgrain durabilitygrain elastucutygrain flow rategrain humiditygrain lossesgrain maizegrain massgrain mass propertiesgrain materialgrain millinggrain moistnessgrain moisture contentgrain of wheatgrain productiongrain puritygrain sievegrain silograin silosgrain sizegrain sowinggrain storagegrain storegrain storinggrain sugargrain yieldgrain’s separationgrained materialsgrainy materialgrainy mediumgrainy plant materialgrantgranual materialsgranular bedgranular heterogeneous mixturesgranular materiaisgranular materialgranular materialsgranular materials mixing degreegranular mattergranular medium heapgranular structuregranularitygranulate kinetic strengthgranulated feedgranulated foddergranulated product durabilitygranulatinggranulationgranulation of seedsgranulatorsgranulometric contentgraph’s methodgrassgrass recognitiongrass tyregrasslandgrasslandsgravimetric methodgreen biomassgreen cropgreen foragegreen landsgreen manuersgreenhousegreenhouse objectgreenhousesgrindergrindinggrinding degreeGRNN neural networksgroats output and qualitygross income of farm familygross profitsground exchangersground filterground grainground heat exchangerground heat exchangersground roasted coffeegroundwater qualitygroup of areasgroup utilisation of machinesgroup utilization of machinesgrowing ploughlessgrowthgrowth and developmentgrowth modelgrowth rateGSMguality management in ISO 9001guar rubberguesthousesgymnosperm barleygymnospermous and angiospermous barleygymnospermous barley
h
habilitationhabitable agents in mountainshabitatsHACCPHACCP systemhand sprayer with batteryhard cheeseshard coalhardeninghardnesshardness indexhardness of granulated productharmful wastesharmfulnessharmonic functionharmonic function with attenuationharmonic function with suppressingharvestharvest costsharvest lossharvest lossesharvest qualityharvesterharvester combinesharvester cropharvester croppingharvester harvestingharvestersharvestingharvesting technologiesharvesting technologyharwarderhaulm separation conveyorhayhaylagehazardhazardshazards caused by the natural forceshazards HACCP systemHCCIheaded boltshealthhealth dangerhealth resortshealth securityheart rateheart rate reserveheart rate reserve indexheatheat and mass transportheat and mass exchangeheat balanceheat consumptionheat demandheat energyheat energy and electricheat energy recoveryheat exchangeheat exchangerheat exchangersheat fluxheat generationheat insulating layerheat lossheat lossesheat of combustionheat penetration coefficientheat processingheat pumpheat pumpsheat recuperationheat screenheat storageheat streamheat surplus and deficiencyheat transferheat transfer coefficientheat treatmentheatingheating characteristicsheating costsheating of the substrateheating powerheating systemheavy metals ionshedonistic scaleheightHellinger statisticsherb processingherb/vegetable mixesherbicidesherring boneHertz theoryheterogeneous granular blendheterogeneous surfaceheterogeneous two component systemhickory burning boiler househigh bush blueberryhigh educationhigh temperature dryinghigh-heat valuehigh-pressure sodium discharge lampshigh-temperature dryinghigher schoolhired labourhomodyne detectorhomogeneityhomogeneous gap heighthomogeneous groupshomogenisation valvehomogenizationhomogenizing headhoney creamhoney crystalshoney heating devicehoney liquefactionhoneyshophorizon saturation or pace of their changeshorizontal displacementhorizontal ground exchangerhorizontal ground heat exchangershorizontal heat exchangerhorizontal integrationhorizontal penetrometerhorizontal pressurehorse beanhorseradish tissuehorticultural frameshorticultural objecthorticultural productionhorticultural substratehotbedshourly fuel consumptionhouse buildinashouse heatinghousehold roadhousehold treatment plantshousehold wastewater treatment plantshouseholdshousinghousing infrastructure in forestrieshousing needs in forestrieshousing systemsHSQL serverHTMLHTML languagehub staminahulled cereal grainshullinghullshuman labour inputshuman workhumidityhumidity distributionhumidity measurementhumidity measurementshumidity ratiohybrid systemhybrid wheathybridshydrationhydrauiic system of a spraying machinęhydraulic characteristlchydraulic cylinderhydraulic impacthydraulic mixinghydraulic model investigationshydrobotanical wastewater treatmcnt unithydrodynamic lubricationhydrogenhydrogen ionshydrostatic drivehydrothermal indexhydrothermal processinghydrothermal treatmenthydrothermic treatmentshygienisationhygroscopic propertieshypothesishysteresis
i
I.C. engine testingI.C.E.-powered sawing machineidentificationidentification algorithmidentification of elementsidentification problemidentification testsillumination flux densityimage analyseimage analysisimage processingimage recognitionIMARK moduleimpactimpact energyimpact matriximpact on the environmentimpedanceimpedance spectrometryimpedancjeimpingementimplementation and developmentimplementationsimproving the qualityimpulse magnetic fieldimpulse measuringimpuritiesimpurities difficult to separateimpurityincidental watersinclinationinclination of the sieveincomeincome sourcesincrease of substance dry massincreased pressureindexindex of non-uniformity of dosageindex of technical work equipmentindexes of wear and durabilityindicatorindicator diagramindice of canopy architectureindicesindividual costs of exploitationindividual energetistic outlaysindividualization of learning processinduction sensorindustrial areasindustrial scalesinequality of air flowinert bedinert materialinfiltrationinfluenceinfluence forceinfluence of highwayinformaticsinformatics infrastructureinformationinformation baseinformation based - electronic systeminformation mapinformation networkinformation resourcesinformation science systeminformation securityinformation sourceinformation supportinformation systeminformation systemsinformation technologyinfra-red radiatorInfraredinfrared radiationinfrastructural investmentsinfrastructural organizationinfrastructureinfrastructure investments communeinhomogeneous granular mixtureinitial fertilizinginitial massinitial moistureinitial statusinitial tensioninitial velocityinitiativeinjectioninjection control systeminjection moldinjection moulding machineinjection pumpinjection systeminjection systemsinjectorinjectorsinnovationinnovationsinoculationinputsinquiryinside temperatureinstalled powerinstant grain coffee concentratesinstant oat flakesinstitutioninstrumental testsinstruments of financingintake cutoffintegrated agricultureintegrated energy systemintegrated forest inventoryIntegrated Pest Managementintegrated protectionintegrated systemsintegrationintensity of agricultural production organizationintensity of productionintensity of production organizationinteraction forceintercroppinginternal auditinternal climateinternal damage indexinternal defectsinternal designinternal forceinternal forcesinternal-combustion engineinternational agreementInternetinternetinternet applicationInternet applicationsinternet applicationsinternet communicationsinternet pagesInternet systeminterpolationinulinaseinundationinventoryinvertaseinvestigationinvestmentinvestment effectivenessinvestment expenditureinvestment inputsinvestment irrigationsinvestment planninginvestment rankinginvestmentsinwertaseion-selective membraneIRDiron reduction)irregular fluctuationsirregularityirrigationISISFETISFET biosensorISO 9001/2000 Standardisochromaisochromatic linesisochromatic patternsisochromsIT toolsIT-based board systemsits structure and quality
j
J2EEJava languageJavaPlatformjelliesjet pumpjoint hub – shaft neckjoint strengthjointed beamJSJSPJSP technology
k
kategory of rural accommodation basiskeeping systemKelvin modelkernelkernelskerosene fuelskeykey wordskind and extent of damageskinds of sewagekinematicskinematics vapourkinetickinetic durabilitykinetic frictionkinetic friction coefficientkinetic of dryingkinetic resistanckinetic resistancekinetic resistance and granulated hardnesskinetic strengthkineticskinetics of the processkinetostaticsKluyveromyces marxianusknowledge baseknowledge representation systemknowledge representationsknowledge verificationKohonen mapkriging
l
L-ascorbic acidL*a*b*L*a*b* systemlabor consumption in productionlabor expenditureslaboratory assessmentlaboratory balancelaboratory investigationslaboratory measurementslaboratory millinglaboratory stovelaboratory testslabourlabour amountlabour consumptionlabour costlabour efficiencylabour expenditurelabour expenditureslabour inputlabour inputslabour requirementsLabViewLAIlakesLANland area groupsland configurationland consolidationland developmentland expanseland information systemsland integrationland limitationsland melioration structuraesland spatial structureland useland use structureland utilizationlandfill gaslands and buildings indexlandscapeLangevin equationLangevine stochastic equationlaser biostimulationlaser biostimulation of seedslaser sensorlaser treatmentlateral distribution of streamlateral friction bearinglateral pressurelayerLDA measurementsleaching of beet seedsleaderleafLeaf applicationleaf area indexLeaf computer applicationleaf state assessmentleaf yieldsleakage removallean beeflearningleaves and sugarlectureleeklegal and planning aspectslegal baseslegal institutionslegal-organizational limitslegislative solutions.legume plantslegume seedsleguminous plantsLemnalengthlength of separating conveyorlentillettuce seedslevellevel of infrastructural developmentlibricatinglifelife cycle assessment methodlife cycle evaluationlifterlifting processlight intensitylight saturationlight soilslightinglighting selectionlimit clearancelimit stresslimitationslinear dimensionlinear generatorlinear velocitylinearly increasing/decreasing changeslinerlinguistic modellingliofilizationlipid oxidationliquid crystalliquid distributionliquid fertilizerliquid fertilizersliquid levelliquid manureliquid manure spreadersliquid outflow intensityliquid outflow rateliquid sprayingliquid-air exchangersLisbon Strategylitterlivestock buildinglivestock buildingslivestock builduinglivestock hallsloadload capacity utilizationload-free creeping testloaderloadingloading chuteloadsloads per secondloam soilloamy soillocal developmentlocal governmentlocal government budgetlocal integrationlocal roadlocal terrain invariantlocalisationlocalization decisionslocationlocation factorslodginglodging degreeloglog-linear functionlogginglogging time consumptionlogging truckslogging woodlogging-transportation technologieslogistic costslogistic curvelogistic infrastructurelogistic regressionlogistic subsystemlogistic systemlogistic systemslogisticslogistics costslong-term financial planslong-term forecastinglong-term investment planlong-term investment planslongitudinal distributionlongitudinal inclinationloose materialsloosened light sandy soillossloss of grainlosseslosses and damages of rootslosses of nutrientslosses of rape seedslow-pressure tirelow-temperature dryinglower critical temperaturelower pods setting heightLower Silesialower sourcelubricating abilitylubricationlucerneluminescence methodslupinelupine celluloselupine seedsLuxembourgluxmeterlying stalllyophilizationlyophilization temperature
m
machinemachine exploitationmachine featuresmachine harvestingmachine milkingmachine milking of cowsmachine milking parametersmachine operationmachine outputmachine parkmachine qualitymachine selectionmachine servicemachine servicesmachine setmachine sharing in agriculturemachine stockmachine stock restoration valuemachine unitsmachine usemachine utilizationmachine work qualitymachineny servicesmachinerymachinery parkmachinery centresmachinery equipmentmachinery maintenance systemmachinery operationmachinesmachines and equipmentmachines assigned to processesmachines diagnosismachines manufacturermachines manufacturer's opinionmacro damagemacro-environmentmagnetic biostimulationmagnetic fieldmagnetic field stimulationmagnetic seed biostimulationmagnetic stimulationmagnetic stimulation of seedsmain stressesmaintenancemaintenance conditionsmaintenance decisions support systemmaizemaize flourmaize grain threshingmaize hybridsmallowmalt barleymalt wortmalt worthMałopolskie voivodshipmanagementmanagement in the farmers' teammanagement of eroded landsmanagement supportmanaging boardmanaging country regionsmanipulation machinemanuremanure managementmanure platemanure spreadermanure spreadersmanuringmap of variationsmappingmapsmaps of cropmaps of minerals contentmarketmarket of tractorsmarket productionmarket statistical analysis methodmarket valueMarkov's chainMarkov’s homogenous processmassmass correlation of featuresmass densitymass exchangemass of damaged tubersmass of kernelmass of undamaged tubersmass potentialmass transfermass transfer coefficientmassage qualitymastitismaterial and energetic outlaysmaterial and energy expenditurematerial and power outlaysmaterial densification parametersmaterialsmaterials with high water contentmathematical modelmathematical formulamathematical modelmathematical model of a systemmathematical modellingmathematical modelsmathematical representationMATLABmatrix methodmaturingmaximal cutting stressmaximum errorsMaxwell modelMDFmeadowmean tip anglemeansmeans of transportmeans of transportationmeasured systemmeasurementmeasurement cardmeasurement conditionsmeasurement errormeasurement methodmeasurement methodsmeasurement of colourmeasurement of cone resistancemeasurement ring methodmeasurement-control systemmeasurementsmeasuringmeasuring controlsmeasuring devicemeasuring positionmeasuring scalemeasuring systemsmeatmeat fillingsmeat productsmeat raw materialsmeat stuffingmechanical bone removalmechanical conditionmechanical damagemechanical damagesmechanical efficiencymechanical harvestingmechanical milkingmechanical milking of cowsmechanical peelingmechanical properatiesmechanical propertiesmechanical qualitiesmechanical seed drillmechanical ventilationmechanical wearmechanical weed controlmechanisationmechanisation costsmechanisation efficiencymechanizationmechanization costmechanization costsmechanization effectivenessmechanization efficiencymechanization factormechanization formsmechanization indexmechanization levelmechanization servicesmechanized technologiesmedical diagnosticsmembrane air-heatermemoryMESMESHmetaheuristicsmetering devicemethodmethod of linear heat sourcemethod of corrected average pricemethod of detectionmethod of determining the adequate temperaturemethod of measurementsmethod of registrationmethod of seed losses recordingmethodicmethodologymethodology of empirical sciencesmethodsmethods of image analysismethods of measurementsmethods of productionmethods of purificationmetoda szacowania plonumetodical approachmicotoxinsmicro damagemicrocartographymicroclimatemicroclimate controlmicroclimate parametersmicroclimatic factorsmicrocomputermicrocomputer controlmicrocontrollermicronizationmicroorganismsmicroprocessor temperature recordermicroreinforcementmicroscope picturemicrotractor tyremicrowavemicrowave and vacuum dehydrationmicrowave and vacuum dryingmicrowave dryingmicrowave drying under reduced pressuremicrowave fieldmicrowave frequencymicrowave methodmicrowave radiationmicrowave stimulationmicrowave vacuum dryingmicrowave-conveciive dryingmicrowave-convection dryingmicrowave-vacuum dryingmicrowave-vacuum dryingmicrowavesmikrowavemildly minced sausagemileage utilizationmilkmilk coolingmilk cowsmilk electric conductivitymilk flow curvemilk flow rate in a machinemilk gualitymilk line fillingmilk outflowmilk pipingmilk productionmilk purchasemilk quotasmilk temperaturemilker’s activitiesmilkingmilking apparatusesmilking automationmilking capacitymilking cowsmilking disturbancesmilking equipmentmilking goatsmilking machinemilking machinesmilking parametersmilking phasemilking pipelines machinemilking robotmilking robotsmilking timcmilking unitmilking unitsmilky fermented beveragesmillet seedmillet seedsmilling propertiesminced cured meat productminced meat massminced sausagesminced stuffingmineralmineral elementsmineral fertilisationmineral fertilizationmineral fertilizersmineral waters intakesminerał watersminimally processed foods; mass exchangeminimisationminimum tillagemining damagesMiscanthus giganteusmixed doughmixed feedmixed flow dryermixed varieties of wheat-rye with azaleamixermixersmixingmixing degreemixing energymixing of funnel-flow systemmixing of grain materialmixing of grainy materialsmixing of granular materialsmixing using the funnel-flow methodmixturemobile energy systemsmobile objectsmodelmodel elementsmodel for back flow in a short milk tubemodel gelmodel of experimental objectmodel studiesmodelingmodeling of movement trajectorymodeling of technical systemsmodeling technological systemsmodellingmodelling of biological processesmodelling of movement trajectoriesmodelsmodels and systems of the description of the imagemodels of developmentmodels of the tyre - soil systemmodernisationmodernizationmodificationmodified atmospheremodified potato starchmodularization and composition rulesmodule modelmodule of elasticitymodulus of elasticitymodulus of elasticitymoist airmoisteningmoistnessmoisturemoisture contentmoisture content (dry basis)moisture content and temperature of grainmoisture content measurementmoisture exchangemoisture metersmoment of inertiamonitoringmonitoring damagemonitoring systemmonoculturemonolayer capacitymonovalent and bivalent systemsMOODLEmorphological featuresmorphological methodmotion conditionmotion equationmotion equationsmotion resistancesmotorwaymouldmountainmountain areasmountain farmingmountain farmsmountain forest biotopic typemountain health resortsmountain pasturemountain regionmountain streamsmountainous economymovable objectmovable objectsmovement characteristicsmovement simulation by computermovement trajectorymowermowersmowingmowing machinemowing machinesmral areaMSc thesesMTAmuftiplexed signal interfacemulchMulti Tankmulti-aisle greenhousemulti-component granular matterMulti-dimensional statisticsmulti-layer biscuitsmulti-track setting of tractor wheelsmulti-zone modelingmulticomponent granular blendmulticomponent granular mixturemulticomponent solid fertlizermulticriteria methodmultifuncional country developmentmultifunctional developmentmultifunctional development of rural areasmultifunctional evelopmentmultifunctionalitymultilayer architecturemultinomial degreemultiplane shutter sievemultiplicitymultiplicity indicesmultizonal modelingmunicipal economymunicipal infrastructuremunicipal water supply systemmunicipalitymunicipality developmentmushroom-growing cellarMustang 306 ECMVC templatemycorrhizamycorrhiza myceliummycorrhiza mycelium typesmycorrhizationmyofibril proteinsMySQL
n
N fertiliserNaClnaked and covered barleynaked wheat grainnarrow tineNational Park in Pieninynatural and forced ventilationnatural circumstancesnatural convectionnatural determinantsnatural drying offnatural environmentnatural gas consumptionNatural infrastructurenatural lossesnatural sorbent of moisturenatural stabilizers structurenatural variabilitynatural wastagesnature monumentnear infrared spectroscopyneeded acreageneedles of sprucenegative pressurenematodanematodesnestnet efficiencynet outputnet productionnetworkneural modelingneural classiferneural modellingneural modelsneural networkneural networksneural networks modelneuron networkneuronal netneuronal netsneurotoxinNEVnew generation agricultural tractorsnew own variablesnew technical solutionsnew technologiesnew technologies of embankment modernisationNewton–Euler methodnitrate contentnitratesnitric oxidenitric oxidesnitrogen dosenitrogen fertilizationnitrogen fertilizernitrogen oxideno-pressure expandingnode numbernoisenoise analysisnoise generationnoise levelnoise propagationNOKIA Digital Pennomenclaturenon-homogenious granual mixturenon-homogenous grainy mixturenon-homogenous granular blendnon-homogenous granular matternon-homogenous granular systemsnon-linear regressionnon-meat additionsnon-Newtonian fluidsnon-plough soil tillagenon-pressure granulationnon-stationary statesnon-threshingnon-uniformity coefficientnon-uniformity of dosagenormal pressurenormal stressesnormal wearnot self-propelled rake swath turnernoxious gasesnozzlesnuclear magnetic resonancenumbernumber of contact pointsnumber of moleculesnumber of observationsnumber of passesnumber of replicationsnumbers in use in agriculturenumeric mapsnumerical and empirical verificationnumerical calculation of flowsnumerical mapnumerical taxonomynurserynursery machinerynursery productionnutrient contentnutrient lossesnutrientsnutritionnutritive cellulose
o
oatsobject databasesobject modellingobject recognitionobject-oriented modellingobject-oriented projectingobjective functionobligatory inspectionOborniki communeoccupational health hazardoccupational positionoccupational riskoccupational risk identificationof milk clawOFDoiloil cakeoil filmoilseed rape seed stratificationOLEDBon-board computeron-line measurementone-sided micro sectionsoniononion seedsonionsopen learningOpen Source softwareopening the soiloperating costsoperating parametersoperating potentialoperating speedoperating speed of seederoperationoperation durabilityoperation of food processing machineryoperation outputoperation qualityoperation systemoperation.operational and economic indicesoperational costsoperational useoperational-economic factorsoperator–vehicle–environment systemoperator's cabinoperator’s cabopokaOpoleoptimisationoptimizationoptimization methodsoptimization modeloptimization of decision casesoptimizing methodsoptimum hand and leg reachoptimum operation timeorchardorchard productionorchard rotavatororchard sprayerorchardsordinary cold storeorganic agricultureorganic fertilizationorganic fertilizersorganic matter balanceorganic substance balanceorganie substanceorganisationorganizationorganization of the productionorganizational achievementorganizational structure of forestriesorganolepticorganoleptic assessmentorganoleptic propertiesorganoleptic quality indicatorsorgatioleptic assessmentosmoprotectansosmotic dehydrationosmotic substanceostrich meatostrich meat productsoutdoor machines researchouter area and sphericity coefficientoutfit and use of technical meansoutflow coefficientoutflow rateoutlayoutlay energyoutlay of workoutlaysoutlays of energyoutputoutside coatoutside walloverall heal loss coefficientoverall heat-transfer coefficientoxycarbonitride of titaniumoxygenoxygen flux densityoxygen stress
p
packagepackaged goodspackagespackagingpackaging agronomypackingpad weldingpaddle agitatorspaddle mixerpaetitionpair comparison methodpaperpaprikaPARPAR distributionparameter selectionparametersparameters of material densificationparameters of material thickeningparameters of milkingparameters of workparametrical modelPareto areaPareto chartParmezan cheeseparsleyparsley rootparsley rootsparsley slicesparsnippart-load operationparticleparticle sizeparticle size distributionparticle size measuringparticulate pollutantspartitionsparts regenerationpassing difficultypasturepasturespattern recognitionpayback periodpayment ratespeapeachpeach treespeak powerPearson statisticspeaspectinsPelega modelpelletpellet durabilitypelletspellets qualityPeltier modulepenpenetration resistancepenetrometerpenetrometer measurementspeopleperceptronperforated duetperformanceperiods of usepermanent grasslandpersonnelpestpest diagnosticspest of potatopesticide content measurementpesticide sensorpHpH measurementpH valuepH valuesphase anglephenologyphenology modelphosphorusphoto elastic methodphoto-elastic modelphoto-thermal cellsphotoelastic methodphotoinhibitionphotosynthesisphotosynthesis inhibitorphotosynthetic electron transportphototermic energy conversionphotovoltaic cellsphotovoltaic systemsPHPphysicalphysical and chemical propertiesphysical and mechanical propertiesphysical dependenciesphysical featuresphysical propertiesphysical properties of soilphysical soil propertiesphysical threats in productionphysical-mechanical properties of soilphysico-chemical analysisphysico-chemical propertiesphysicochemical propertiesphytotoxicitypicklingpicture documentationpieces of applespiezoelectric resonancepig farmingpig fatteningpig herdspig's taking to piecespigeons feedpiggeriespiggerypigletspigmentspigspigs welfarepinpin sowing unitpine bolt bucklingpine bolt slendernesspine spot sowingpipeline milking machinepiping enclosurepixelplaceplain wedgeplan of temperaturesplane of atomizationplanimetrical propertiesplanningplans of experimentsplantplant applicationplant characteristicsplant cultivationplant densityplant developmentplant emergenceplant granular materialsplant growthplant materialplant materialsplant pathogensplant productionplant protectionplant protection chemicalsplant residuesplant technologyplant tissueplant tissuesplant yieldsplant-environment interrelationplant-ground bedplantationplantation cardplanterplantersplantingplanting arrangementplastic tunnelplasticizerplateplate granulationplate solar collectorPLC ControlPLC controllersPLC driver applicationplonplot of groundploughplough shareplough sharesploughingploughsploughshareploughsharesplum butterplungerspneumatic cleaningpneumatic separationpneumatic transportationpneumatic wheelspod harvestingPoisson coeff i-cientPoisson's ratioPolandPolish Association of Agricultural Engineeringpoll researchpollutantspollution of natural environmentpolyamide beddingpolyethylene greenhousepolygonal stempolymer’s identificationpolymers utilizationpolynomial regressionpomacepondpoolpopularizationpopulationpopulation modelspopulation numberporkporkersporosityporosity coefficientporous carrierporous structureportable computerportalpositioningpositioning accuracypossession of engineering equipment in farmspost-harvest grain maintenancepost-harvest maintenancepost-harvest treatmentpostponed bakingpotassiumpotatopotato bulbpotato croppingpotato cubepotato flourpotato harvest/croppotato harvesterpotato productionpotato sprayingpotato tuberpotato tuber pulppotato tuber tissuepotato tuberspotato varietiespotato varietypotatoespotentialpotential assessmentpoultry keepingpoultry pelletpoultry production and raisingpowderpowdered foodpowerpower consumptionpower demandpower efficiencypower engineeringpower equipment and utilitiespower for agricultural machinespower generation waste usagepower of the wind power plantpower outputpower output of power plantpower plantationspower requirementpower resources usepower scythepower take off shaftpower to confer academic degreespower transmission systempower willowpower-related efficiencypower-splitpre-compaction stresspre-sowing laser biostimulationpre-sowing tillagepre-treatmentprecise agricultureprecision farmingPrecision Agricultureprecision agricultureprecision farmingprecision pairsprecision seedingprecision sowingprecompaction stresspredictingpredictionprediction of ecological consequencespredictive diagnosticspreliminary sprinkling bedpremixpreparation of samples to testingpreparation to experimentspreparatory stepsprepared cerealprepared seed-gramspreservationpreservation diseasespreservation technologypreservation wastespreservativepreservativespreserving preparationspresowing magnetic biostimulationpress drill seederpressingpressurepressure accumulatorpressure forcepressure homogenizerpressure parameterspressure ratiopressure regulating devicepressure sensorspressure seweragepressure tankpressureless expandingpretreatmentpreventionprevention of the euvironmentpreyingpricepricespricingprimary energyprincipal component analysisprincipal components methodprinciple of minimaxpro ecological investmentspro-environmental investmentsprobabilistic methodsprobabilistic modelprobabilistic netsprobabilistic networksprobability of ripeningprocessprocess controlprocess designprocess diagnosticsprocess kineticsprocess managementprocess of cutting kernelsprocess of machines purchaseprocess performanceprocess simulationprocess temperatureprocessesprocessingprocessing of measure resultsprocessing of vegetablesprocessing technologyproduct Pro/MECHANICAproduct qualityproductionproduction capacityproduction costproduction costsproduction directionproduction facilitationproduction incomeproduction intensityproduction lineproduction meansproduction methodsproduction of heat from animalsproduction organisation intensityproduction organizationproduction organization intensityproduction processproduction process controlproduction process modelingproduction profitproduction profitabilityproduction simplificationproduction specializationproduction systemproduction technologyproduction technology modelproduction trendproduction typeproduction valueproductions costsproductive effectsproductivityproductsproducts for utilizationproecological investmentsproenergetic plantsprofessional educationprofessional hazardsprofessional statusprofessorprofileprofile measurement gaugeprofitabilityprognosisprogrammable controllerprogramme for farmersprogressprogress effectivenessprogressive movementprojectingprojectspromotionproofproper energy of the deformationpropertyprospective technology of mycorrhizationprotected areaprotection of winter oilseed rapeproteinprotein contentproteinspsychical fatiguepsychological burdenpsychotropic florapublic opinion researchpublicationpublicationspublishing companypull forcepulling forcepulling out timberpulling out timber tractorpulsationpulsation phasespulsation systempulsatorpulsator parameterspulse feederpulse ratepulse reserve utilization coefficientpulserpulverizing aerationpump stationpumping sectionspumping valvespumpkinpurchasepurchase of farm machinespure productionpureepuritypurple willowpurpose function
q
QDAqualitative outfittingqualitative propertiesqualititative classesqualityquality evaluation of grain configurationquality factorsquality managementquality management systemquality of cuttingsquality of dried productquality of electric power supplyquality of granulated fodderquality of kernels cuttingquality of seedingquality of seedsquality of supply voltagequality parameters of electric energyquality propertiesquality systemsquality tillagesquantitative demandquantitative outfittingquantity and quality of cropquarter milkingquestionnairequestionnaire surveyquiz
r
radar sensorradial compressionradial positioningradial run-outradiationradicular systemrail transportrainfallraising agentsrakingraperape bio-fuelrape oilrape oil esterrape seed harvestingrape seedsrape-seed oilrapeseedrapeseed biofuelrapeseed cakerapeseed methyl estersrapeseeds dryingrapid hydraulic structureraspberriesraspberryrate of developmentrate of travelratingratio of mechanical damagerational waterrationalisation of investment managementraw material and material outlaysRCDRDF methodreadily dispersible clayreal estaterealibilityreauirementsreauirements and efficiencyreąuirementsrecirculationreconstruction valuerecyclingred beetred beet seedsred cloverreduced pressurereduced tillagerefrigerating machineryrefrigerating systemrefrigeration treatmentrefrigerators to milkrefurbishment of farm machineryregenerationregime springregionregional developmentregional tourism organizationsregressionregression analysisregression equationregression equationsregression functionregression modelregressive modelregulationrehydratation of dried vegetablesrehydratingrehydrationrehydration coefficientreinforced concrete pipesreinforced earthreinforced soilreinforced soil embankmentreinforcementrelation databaserelational databaserelational databasesrelational modelrelative humidityrelative linear deformationrelative sensitivityreleasing the proteinsrelia-bilityreliabilityreliability modelsremote measuringremote teachingremovalrendered servicesrenewablerenewable energyrenewable energy carriersrenewable energy resourcesrenewable energy souecesrenewable energy sourcerenewable energy sourcesrenewable fuelrenewable sources of energyrenewalrenovating recyclingrenovation of partsrentabilityrepairrepair baserepair shoprepairsrepeated compactingrepeated strainsrepiantingreplacement valuerepresentative learning datarepresentative teaching datareproduced valuereproduction value of farm machineryreproductive value of machinery parkrequirementsrequirements of work safety and hygieneresearchresearch experimentsresearch filmresearch managementresearch methodologyresearch metodsresearch personnelresearch test standreservesreservoirresidential space heatingresidual sum of squaresresiduesresistanceresistance heating wireresistance measurementsresistance propertiesresistance to squashingresolutionresource and energy sawvng technologiesresourcesrestaurants and catering enterprisesresting jointsrestoration valueresultant temperatureretaining waliretaining wallsretention water reservoirreturn on investmentreturnsreutilizationreversed air-flowReynolds equationrhelogical propertiesrheologic propertiesrheological model of soilrheological proper-ties of doughrheological propertiesrheological proprietiesrheologyrhizoctonia solaniRiccati equationrice flourridgeridgesrigidityring matrixring roadsripeness of applesriskrisk analysisrisk estimationrisk managingriverriver embankmentsriver trainingRMERME biofuelRME biofuelsRME fuelroadroad culvertsroad foundationroad through the villageroadsroastingroasting in oilrobiniaRobustarock-bedroll separator-cleanerroller crusherroller feed millroller test standrolling pressrolling pressesrolling resistance coefficientrolling resistance force of the towed tireroofRoof Shaped Insert systemroofingroofing materialsroofingsroostsroot celeryroot cropsroot losses and damagesroot parsleyroot vegetablesroot yieldsroot zonerotary chuterotary rheometerrotary ripperrotary tillage machinerotationrotation of herbicidesrotation speedrotational pairsrotational speedrotational-settling vatrough setsroughnessround big balesround holeround orificerubberrubber baserural arearural areasrural areas developmentrural communesrural consumersrural customersrural developmentrural distribution networksrural environment protectionrural householdsrural infrastructurerural infrastructure.rural LV networksrural regionsrural youthruralinrastructurerusty soilryerye flourrye grain
s
saccharinesaleSalix ViminalisSalix viminalissalt diffusionsample sizesampling gridsanitary requirementssanitary waste dumpsatellite navigationsaturationsaturation concentrationsaw chainssawing machinescales accuracyscarificationscattered seedingscattering indexscattering processscenarioScheffe´s trust rangesciencescience tasksscientific achievementscientific and technical progress efficiencyscientific and technological progressscientific centerscientific conferencescientific degreesScientific Networkscientific researchscientific school. publicationscientific staffscientific-technical progressscope of researchscreenscreen analysisscreeningscreening efficiency distributionscrew agitatorscriptssearch engineseasoningsecond drying periodsecondary marketsecondary sourcessectionsedimentation numberseedseed coatseed calibrationseed cleaningseed coat strengthseed coating gluesseed covering with soilseed crushingseed damageseed damagesseed distribution analysisseed dryingseed geometryseed germinationseed grainseed grindingseed lossesseed modelseed peaseed purityseed qualityseed shapeseed sizeseed sproutingseed yieldseed-coatseed-potatoseedersseeding qualityseedsseeds elasticityseeds lossesseeds of flowersseeds of ropeseeds of wheatseeds samplesseeds self-sortingseeds' sizesseeds’ coatingseepage.segmentationsegregationselectionselection criteriaselection of machineryselection of machinesselection of parametersselection of transport meansself-heatingself-ignitionself-lockingself-organizing mapself-segregationsemi-automatic calibrationsemi-flaky pastrysensitivity analysissensitivity of soilsensorsensory analysissensory assessmentsensory desirablesensory evaluationsensory qualitiesseparating assembliesseparating unitseparationseparation efficiencyseparation of grainseparation processseparation propertiesseparatorseries of typesserradillaserver model diagramserviceservicesservicingservletservomaotorset theory modelsettlement networksettlement systemsettlement unitsettling-whirl vaultsewagesewage inflowsewage sludgessewage systemsewage systemssewage treatmentsewage treatment plantsewage treatment plantssewage volumesewage-free water consumptionsewage-treatment plantssewerage systemsewerage systemsshading screensshaft and axisshaking mechanismshallow reversalshapeshape and size of particlesshape factorshape indexshareshare distributionsshare liftershare stubble tillershear boxshear strengthshear vaneshearingshearing forcesheep milkingshieldsshort-term forecastingshort-term seeds strengthshouldershovelling machineshreddershreddingshrinkageshrinkage coefficientshutter screenshutter sieveshutter’s sievesievability distributionsievesieve analysis of seedssieve geometrysieve separationsignal amplitudesilagesilica fumesilosilossilvopastoralismsimple load cyclesimplified cultivationsimplified cultivation technologiessimplified technologysimplified tillagesimulation experimentsimulationsimulation modelsimulation programsimulation testSIMULINK packagesimultaneous and alternate pulsationsimultaneous pulsationsingle – and two – stage processsingle and multicompoudt fertilizersingle solid fertilizersingle-seed sowingsizesize of buildingssize of kernelssize of loadskew-symmetrical wedgeskiddingskidding efficiencyskidding of wheelsskimmingslaughterslaughterhouseslicingslideslide bearingslipslippageslopeslope grass-soil bedsslow-release fertilizerssludge treatmentslurry manuresmali retention reservoirssmali watercoursesmall water power plantsSMDSMEsmoke flowratesmokingsmoking-blanching chambersmooth frictionsnowbreakssoakingsocial infrastructuresocietysocio-economic developmentsocióeconomlc statussodsodiumsoftwaresoftware productssoilsoil bulk density and water contentsoil clodsoil compactionsoil compactnesssoil cone indexsoil cultivationsoil cultivation toolssoil cuttingsoil cutting forcessoil cutting resistancesoil deformationsoil degradationsoil densitysoil electrical conductivitysoil heatingsoil humiditysoil hydratationsoil limingsoil mappingsoil moisturesoil moisture contentsoil oxygenation managementsoil packingsoil preparationsoil pressuresoil propertiessoil propertysoil reactionsoil resistancesoil samplingsoil semispacesoil stabilizationsoil stimulatorsoil stresssoil stressessoil stricturesoil structuresoil surfacesoil tillagesoil tillage machinessoil typesoil volumetric densitysoil water contentsoil wedgesoil-plant bedsoil-vegetable methodssoil-water erosionsoil-wheel interactionsoil's electrical conductivitysoil's electrical conductivity mapsoilcompacionsolar (energy) collectorssolar collectorsolar collectorssolar conditionssolar energysolar energy conversion systemssolar installationsolar radiationsolar radiation collectorssolar radiation sumssolar-power ventilation devicesolids gainsolubilitysonificationsorbatesorbentsorbitolsorptionsorption isothermssorption kineticssorptive propertiessortingsorting plantssorting processsources of financingsources of hazardssow analysissowingsowing concentrationsowing depthsowing ratesoybeansoybean mealspace structureSpainspasspatial analysisspatial correlation coefficientspatial differentiationspatial information systemsspatial land managementspatial managementspatial planningspatial structure of groundsspatial typologyspatial variabilitySPCspeciespeciesspecific costspecific densityspecific energy consumptionspecific energy consumption indicesspecific heatspecific pressurespecific pressuresspecimentspeckle photographyspeckle photography methodspectral analysisspectral analysisspeedspeed of the movespeed profilespheric profile coefficient of tubersspherical coefficientspherical shape coefficientssphericity coefficientssphericity indicesspheroidal cast ironspinachsplinesSPOSPO WKPsponge cakespontaneous ignitionspouted bedspouted bed dryerspouted bed dryingspouted drierspouted dryerspray coveringspray depositspray distributionspray driftspray dropletsspray dryingspray liquid distributionspray techniquesprayersprayer inspectionsprayer outputsprayerssprayingspraying anglespraying machinespraying techniquespread of oilspreadersspreading machinespringspring barleyspring plantingspring wheatspring yieldspringssprinkled filtration bedssprinkler irrigationsprinklingsprinkling inequalitysprinkling machinesprout incrementsproutingsprouting lossesSQLsqueezingsqueezing processSSNSSN modelstabilitystabilizationstabilization of ground with cementstabilization of sewage sludgesstabilization of vacuumstabilization system vacuumstaffstaff policystagesstalkstalk diameterstallstandstandard cold storestandard deviationstandardsstarchstarch contentsstarch indexstarted phasestatic loadstatic plate mixerstatic pressurestatic resistanceSTATISTICAstatistical analysisstatistical controlstatistical distribution of humiditystatistical dynamicsstatistical modelstatistical modelingstatistical modellingstatistical modelsstatistical process controlstatistical teststatistical testssteamsteam consumptionsteamingsteelsteel barrelsteel basesteel silosteeringstemstep changesstep of grinding downstereological methodsstickiness and resiliencestiffnessstimulationstimulation of seedstochastic modelstochastic processesstock of machinesstonestone heat regeneratorstone regeneratorstoragestorage changesstorage durationstorage lossesstorage modulesstorage of applestorage of fertilizersstorage of seed massesstorage periodstorage reservoirstorage value of potatostorage-recreational reservoirstorages diseasesstorestoresstoringstraight wedgestrain gaugestrategystrategy of rural developmentstrawstraw burning boiler housestrawberriesstrawberrystreamstream densitystream of airstreambed zonestrengthstrength featuresstrength propertiesstrength-related proprietiesstreptomyces scabiesstressstress concentrationstress distibutionstress factorsstress relaxationstress relaxation teststressesstresses in environmentstructural fundsstructural modelstructural policystructural-cum-mechanical propertiesstructurestructure creationstructure forming processstructure of costsstructure of expendituresstructure of water consumptionstructure soilsstructure stabilitystructure taxonomystructure-generating additivesstructure-generating substancesstudentstudentsstudents’ knowledgestudiessub gradesub-germinationsubarable layersubgrad on the country areasublimationsublimation dryingsublimation-cum-vacuum-cum-steam defrostingsublimation-steaming-vacuum thawingsublimation-vacuum-steam defrostingsubsoilsubsoil layersubsoil slopesubsoilersubsoiling and sowingsubstitutionsubstratesubstrate desinfectionsucking negative pressuresucking of false airsucrosesudden damagesSudetensugarsugar beetsugar beet harvesterssugar beet rootsugar beet seedsugar beetssugar contentsugar contentssugar extractionsugar maizesugar market reformsugar-beet harvesterssum of rest squaresSun radiationsunny energysunny installationsuperpositionsupervisionsupplaying chainsupplierssuppliessupportsupport of decision-makingSupport Vector Machinesupporting decision-makingsupporting elementssurfacesurface areasurface lagersurface of apple slicessurface pressuresurface pressuressurface watersurface wearsurface weldsurveysusceptibility of constraintssuspended toolsuspension fertilizersustainability agricultural productionsustainable agricultural productionsustainable agriculturesustainable developmentswath turningsweet cornsweet maizesweetenersswellingswelling of seedsswineswing ploughsSWOT analysissyllabusessymmetric diagonal wedgesynthetic materialssystemsystem efficiencysystem integrationsystem L*a*b*system modelingsystem modellingsystem of agricultural productionsystem of soil cultivationsystems modellingsystems of cow breedingsystems of spatial information
ś
świrzepa radish hulls
t
t-p-c associationtabletingtap densitytarget identificationtastetaxonomy methodteam use of machinesteatteat cupteat gumteat massageteat-cup rubber linertechnical advancestechnical and operational parameterstechnical and organizational solutionstechnical assessmenttechnical characteristicstechnical conditiontechnical consolidationtechnical development indextechnical diagnosticstechnical equipmenttechnical equipment indextechnical equipment of farmstechnical forecastingtechnical informationtechnical infrastmcturetechnical infrastructuretechnical infrastructure indicestechnical infrastructure of rural areastechnical meanstechnical means of productiontechnical means of worktechnical objecttechnical parameterstechnical production resourcestechnical prognosestechnical progresstechnical progress efficiencytechnical readiness indextechnical resourcestechnical rural infrastructuretechnical servicetechnical statetechnical surveystechnical systemtechnical territorial developmenttechnical weartechnician of sprayingtechnicstechnikal equipmenttechniquetechnological advancementtechnological developmenttechnological index of equipmenttechnological linetechnological mistakestechnological processtechnological processestechnological progresstechnological quality of rootstechnological standardstechnological valuetechnological value of potatotechnologies of tillagetechnologlcal meanstechnologytechnology leveltechnology of cultivationtechnology of milkingtechnology of picking up wet haytechnology of productiontechnology of rape cultivationtechnology processtechnology XMLteclinical equipment of farmstectonics window of Mszana Dolnateleinformation processestemperaturetemperature changestemperature distributiontemperature equalizing coefficienttemperature in the roomtemperature measurementtemperature of dryingtemperature of wastetemperature predictiontemperature recordertemperature regulationtemperatures scheduletendencies of developmenttendernesstension relaxation testtermterminologyterrainterritorial grouptest equipmenttest numbertest of direct shearingtest standtestingtesting methodstesting of hypothesistesting proceduretesting researchtestsTetra-Pak machinerytextural propertiestexturetexture parameterstexture propertiestexture stabilizersthawingthawing timetheoretical analysistheoretical shaft outlinethermal balancethermal camerasthermal conductivitythermal conductivity coefficientthermal contractionthermal effect diagrammethermal energythermal energy storagethermal energy storingthermal expandingthermal expansionthermal insulating powerthermal insulationthermal modernizationthermal processingthermal screenthermal stressthermal treatmentthermally modified pectinsthermocouplethermoelectric cellthermographythermoinnsulatory materialsthermoisolation of the animal’s environmentthermoopticsthermoplastic starchthermostatic processingthermotherapythermovisionthesisThetaProbe (ML2x)thickeningthicknessthickness of fruit and seed coatthinningthixotropyThree layer architecturethree-point rear suspension systemthreshing energy consumptionthreshing processthreshing unitsthroughputTi(OCN)tillagetillage erosiontillage simplificationstillage systemtillage toolstimbertimber acquisitiontimber hardnesstimber sorttimber yardtimber yardstimberwoodtime density characteristictime prognosingtime seriestime series modelstime structuretime trajectorytime-effecttimekeepingtimingtinned fish productsTitus 25 WGtixotropic effect tixotropic liquidtolerancetolerance limitstomato growingtomatoestooltool cutting edgeangletool position coordinatestoolstopinambourtopographic visualisationtopping qualitytorsion flexibilitytotal hardness reductiontotal heat balanceTotal Productive Managementtotal productive managementtourismtourism producttouristic attractivitytower silotoxic componentsTPCTPMtraceabilitytraction efficiencytraction forcetraction forcestraction parameterstraction parameters of the wheeltraction propertiestraction wheel parameterstractive forcetractortractor aggregatetractor enginetractor operationtractor outfitstractor sprayerstractor spraying machinestractor usagetractor vibrationstractor wheelstractor- machine outfittractor–agricultural machine unittractorstraditional pork sausagestraditional technologytraffic optimisationtrainingtrajectory of the movetranceivertranscient modeltransition ratetranslationtransmission unittranspirationtransporttransport in agriculturetransport meanstransport of the damptransport systemtransport-related issuestransportationtransportation vehiclestransportation volumetransported load masstransverse distributiontransverse distribution of liquidtread areatreatmenttreatment planttree barktree defoliationtrees replantingtrend function selectiontrendstrends in land developmenttriazinetriazine herbicidestribological processestribometertrieur with bar-type working surfacetriticaletube rheometertubertuber contaminationtuber size fractiontuber sproutingtuber storagetubular housingtubular spannerturfgrassturnturning the soilTV transmissiontwo – stage crushing processtwo yarietiestwo-component food productstwo-dimensional codetwo-fan sprayertwo-plane sievetwo-ply tillagetwo-stage dryingtypetype forest sitetype of coulterstype of soiltype seriestypes of farmstypical power load diagramstyretyre stiffnesstyre vertical deformation in the soiltyres
u
udderUE requirementsUkrainian CarpathiansULO chamberultrasonicultrasonic treatmentultrasonographicultrasoundultrasoundsUMLUML diagramsUML modelingunder-pressurized wastewater disposalunder-teat chamberunder-threshingunderground waterunderground watersunemploymentunevennessunhusked buckwheatuniaxial creep testuniformityuniformity of batchuniformity of dosageuniformity of tubers distributionunion foundsunitunit costsunit energyunit energy consumptionunit energy useunit fuel consumptionunit operating costsunit pressure forcesunitary fuel consumptionunitary maintenance costsunitary power outlaysuniversityuniversity level tuitionunloadingupper critical temperatureupper heat sourceupright mixer with worm agitatoruptakeusability assessmentusability of obtained educationusable heatusable softwareusageusage efficiencyusage processusage ratiosuseuse intensityuse modeluse of computersuse of internetuse of machinesused servicesuseful individual warmthsusefulnessuseruser’s knowledgeusers' needsusing of technical means in the EUutilisationutilizationutilization parametersutylization sewage
v
vacuumvacuum dryingvacuum effectvacuum fluctuationsvacuum hesitationsvacuum parametersvacuum parameters of milkingvacuum preservation of grainvacuum pressurevacuum seweragevacuum stabilityvacuum tankvacuum tube solar collectorvaluationvalue estimationvalue of daily solar radiationvalue of farming groundsvaluingvalve homogenizingvapour adsorptionvariable rate fertilizationvarietyvariety country regions developmentvegetablevegetable dryingvegetable fuelsvegetable grainy materialsvegetable granular materialsvegetable juicesvegetable materialsvegetable productionvegetable seedsvegetablesvehiclevehicle utilizationvehiclesvelocity distributionvelocity of wave propagationventilating equipmentventilationventilation and feeding controlventilation ductventilation irregularityventilation systemverificationvermin of the potatoversatility of critical node methodvertical exchangervertical forcesvertical ground exchangervertical ground heat exchangersvertical heat exchangervertical pressurevery early varieties of potatoesvery light soiivery light soilviabilityvibrationvibration processvibrationsvibroacoustic diagnosticsvibroacoustic methodsvideo cameravideo computer techniquesvideo filmsvideo-computer methodvideo-techniquevillagevillage areasvillage system of buildingvillage with a lot of functionsVirginia mallowvirtual educationvirtual instrumentsvirtual measuring instrumentvirtual modelvirus fightingviscoelastic propertiesviscoelasticityviscosityviscosity and elasticity propertiesvisual programmingvisualisationvisualization datavisualization of measurementsvisualization of productive processesvitamin Cvitamin C contentvitreosity of grainvitreousity and temperature of grainvoice transmissionVoIPvoltage levelsvolumevolume measurementvolume of domestic sewagevolume of single seedvolumetric densityvolumetric soil moisturevulnerability
w
WANwarehousewarunki suszeniawashability of flakeswashing effectivenesswashing processeswashoutwastc management systemwastewaste energy recoverywaste management systemwaste organic biomasswaste utilizationwasteswastewaterwastewater disposawastewater disposalwastewater treatmentwaterwater absorptionwater activitywater adsorbtionwater adsorptionwater and fat con-tentswater balancewater consumptionwater consumption structurewater contentwater contentswater dammingwater diffusionwater erosionwater food solutionswater hydraulic structureswater intakewater levelWater losswater losswater losseswater managementwater pricewater protectionwater qualitywater retentionwater sensitive paperwater stability determinatorwater storage capacitywater supplywater supply systemswater turbiditywater use efficiencywater utilisationwater vapburwater vapourwater vapour adsorptionwater-headwater-pipe networkwater-suapply managementwater-supply serviceswater-supply systemwaterworkswavewave propagation speedways and technique for ensilageways of financingwaysidewearwear and tearwear intensitywear mechanismwear of atomizerswear of ploughsharewear of steelwear testing machineweather conditionsweb applicationswedge angleweed controlweedsweeds recognitionWeibull statisticsWeibull's distributionweight of 1000 seedswelding equipmentwelfarewell-balanced developmentwell-balanced farm productionwell-balanced productionwell-beingwellswet haywheatwheat bakerywheat branwheat breadwheat breadstuffwheat flourwheat flour. rye flourwheat grainWheat grain dryingwheat grain dryingwheat grainswheat kernelwheat seedwheat seed grainwheat seedswheat silowheat-ryewheelwheel loadwheel loadswheel resistance forcewheel resistance forceswheel skidwheel slipwheel spinwheel tracewheel track depthwhirling-settling vatwhite lupinewhite mustardWi–Fiwide-pitch conveyorwidthwidth between seed rowswierzba energetycznaWiFi networkwild radish segmentswillowwillow biomasswillow pestswillow sprout cuttingswillow stem volumewind energywind engineswind power plantwind power plantswind power stationwind speedwinewine colourwine ripeningwinter barleywinter cerealwinter oilseed rapewinter rapewinter rape seedwinter rapeseedwinter ryewinter triticalewinter varietieswinter wheatwinter wheat cultivarswireless computer networkswireless networksWLANwomen workwoodwood acquisitionwood acquisition efficiencywood basewood chipswood exploationwood isobarwood isothermwood skiddingwood transportwood typewood usewooden buildingswooden pavementwoodlandwoodlotsworkwork conditionswork consumptionwork cyclework efficiencywork expenditurework expenseswork on cuttingwork planningwork process equipmentwork safetywork safety culturework safety managementwork station lightingwork timework–standsworking capacityworking conditionsworking depthworking elementsworking gapworking parametersworking parameters of cutterworking processworking qualityworking resistanceworking resistancesworking speedworking speed of the seed drillworking standsworking surfacesworking systemworking timeworking vacuum systemworkloadworkloadsworm agitatorworm mixerwort linewrench spannerWTOWWW service
x
X2 test of fit goodnessX2 test of independenceXilinx®XMLxperiments in situ
y
yearly loadyearsyeastyeast K.marxianusyeast slurryyellow lupinyieldyield and qualityyield mapyield of grain wheatyield of grainSummaryyield of rootsyield predictionyield qualityyield recordingyield structureyieldingyieldsYoung moduleYoung's modulus for grains
z
zabiegi wstępneZeiss-Conimeterzoohygienezootechnical ergonomy
Si sous remarquez les erreurs, contactez Redakcja PTIR, s’il vous plaît